Create issue ticket

20 Possible Causes for 37 kDa, RBP

Show results in: Română

  • Progressive Retinal Dystrophy due to Retinol Transport Defect

    […] with the carboxy terminus of RBP.[genecards.org] kDa including tags Amino acids 2174 to 2273 Our Abpromise guarantee covers the use of ab114660 in the following tested applications.[abcam.com] ATRol, also called vitamin A, is a fat soluble compound that is transported in the blood and stored in the liver by mostly combining RBP.[iovs.arvojournals.org]

  • Plasmodium Vivax

    Identification of rbp Genes.[dx.doi.org] Pathogen: Plasmodium vivax Description: P. vivax interspersed repeats Ortholog group: vir/kir Family size: 600-1000 Chromosome locations: Subtelomeric Protein: VIR Size: 30-37[vardb.org] P. vivax Duffy-binding protein (DBP 25 ) and reticulocyte-binding proteins (RBPs 26 ) are the archetypes of two distinct Plasmodium families of cell-binding proteins involved[nature.com]

  • TTR Amyloidosis with Polyneuropathy

    Usually only one binding site for thyroxine and one binding site for RBP are occupied at a given time.[bcm.edu] )], clusterin (CLU; 37 kDa), vitronectin (VTN; 75 kDa), cadherin-5 (CDH5; 90 kDa), complement C1s (C1S; 86 kDa), and α2-macroglobulin (A2M; 180 kDa) ( Fig. 5 , D and E).[stm.sciencemag.org] Effect of natural interactors, thyroxine and RBP, on proteolysis/fibrillogenesis by Ser52Pro TTR.[pnas.org]

  • Familial Congenital Mirror Movements 2

    RBL25934P130, Rb2retinoblastoma-like 2 (p130) RBMX27316HNRPG, RBMXP1, RBMXRT, RNMX, hnRNP-GRNA binding motif protein, X-linked RBPJ3516AOS3, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J[grnpedia.org] Predicted molecular weight: 37 kDa. ICC/IF 1/100 - 1/1000. IHC-P 1/100 - 1/1000.[abcam.com] The protein encoded by the RAD51 gene is made up of 339 amino acids and has a molecular mass of almost 37 kDa.[cags.org.ae]

  • Lethal Arthrogryposis - Anterior Horn Cell Disease Syndrome

    Thus, it will be interesting to define differences in the composition of those RNA-binding proteins (RBPs) associating with both wild-type ( COL1A1 and DMPK ) and mutant ([dmm.biologists.org] kDa including tags Amino acids 140 to 240 Our Abpromise guarantee covers the use of ab114682 in the following tested applications.[abcam.com] Amino Acid Sequence Accession Species Human Sequence RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLRE VMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKE E Molecular weight 37[abcam.com]

  • Membranous Glomerulonephritis

    Increased urinary RBP was observed in two patients. The urinary osmolality in nine patients was lower than the normal range.[doi.org] N-terminal fragment, 36 , 37 , 38 as well as with intramolecular epitope spreading. 39 Heymann nephritis-like membranous nephropathy was also reported in rats and mice, 40[doi.org] The urinary retinol-binding protein (RBP) was normal when it was less than 0.5 mg/dl. The normal urinary osmolality was higher than 800 mOsm/kg H 2 O after fasting.[doi.org]

  • Leptomeningeal TTR Amyloidosis

    ., Vitamin A or retinol binding protein (RBP).[patents.google.com] )], clusterin (CLU; 37 kDa), vitronectin (VTN; 75 kDa), cadherin-5 (CDH5; 90 kDa), complement C1s (C1S; 86 kDa), and α2-macroglobulin (A2M; 180 kDa) ( Fig. 5 , D and E).[stm.sciencemag.org] A novel compound heterozygote (FAP ATTR Arg104His/ ATTR Val30Met) with high serum transthyretin (TTR) and retinol binding protein (RBP) levels.[bumc.bu.edu]

  • Human Herpesvirus 8

    Transactivation of the KSHV K-bZIP promoter by Rta requires the cellular protein RBP-Jk ( 7 , 77 ).[doi.org] The predominant variant of gpK8.1 that is present in cellular membranes migrates with an apparent molecular weight of 35–37 kDa.[doi.org] A 35–37 kDa glycoprotein has been a protein most frequently and intensively detected, and corresponded to the K8.1 Orf of HHV-8 [ 220 ].[doi.org]

  • Distal Myopathy Type Tateyama

    Although the mechanisms underlying the selective skeletal muscle involvement remain to be elucidated, the immunohistochemical results suggest a broad sequestration of RBPs[ng.neurology.org] Genet. 20 , 37–42 (1998). 21. Azlbi, K. et al .[nature.com] VCP , 1 hnRNPA1 , 2 hnRNPA2B1 , 2 SQSTM1/p62 , 3 and MATR3 genes. 4 , 5 Heterogeneous nuclear ribonucleoproteins (hnRNPs) are ubiquitously expressed RNA-binding proteins (RBPs[ng.neurology.org]

  • Gastric Carcinoma

    SHARP is a novel component of the notch/RBP-Jkappa signalling pathway. EMBO J. 2002;21(20):5417–26.[bmcmedgenomics.biomedcentral.com] In particular, spot 402 at 50 kDa and spots 526 and 548 at 37 kDa were of interest by showing an increased expression in tumor tissues.[ncbi.nlm.nih.gov] […] and the cleaved forms containing the fragment D at 37-40 kDa, which corresponded to 19 spots in 2DE.[ncbi.nlm.nih.gov]

Further symptoms