Create issue ticket

232 Possible Causes for 38 kDa, Autographa, californica, nucleopolyhedrovirus, protein

Show results in: Italiano

  • Bombyx

    AcMNPV is closely related to Bombyx mori nucleopolyhedrovirus (BmNPV), and nucleotide sequences of AcMNPV genes have high similarity with those of BmNPV.[ncbi.nlm.nih.gov] In this study, we screened BmREEPa interacting protein through co-immunoprecipitation and finally identified a membrane protein, Bombyx mori patched domain containing protein[ncbi.nlm.nih.gov] Abstract Autographa californica multiple nucleopolyhedrovirus (AcMNPV) can easily enter and transduce foreign genes into mammalian cells, but these functions are difficult[ncbi.nlm.nih.gov] A. californica M NPV protein P74 is associated with the ODV envelope.[jvi.asm.org] Whole silkworm pupa proteins were separated by SDS-PAGE and 2-D PAGE.[ncbi.nlm.nih.gov]

    Missing: 38 kDa
  • Banna Virus

    Frog virus 3 V Lymphocystivirus Lymphocystis disease virus 1 V Megalocytivirus Infectious spleen and kidney necrosis virus V Baculoviridae Nucleopolyhedrovirus Autographa californica[jams.med.or.jp] VP2 is the 'T 2' protein that forms the innermost 'subcore' layer, whilst VP8 is the 'T 13' protein forming the core-surface layer.[ncbi.nlm.nih.gov] Proteins with dsRNA-binding domains or with significant similarities to polymerases, methyltransferases, NTPases or protein kinases were identified.[ncbi.nlm.nih.gov] VP9 is a major protein in virus-infected cells and is a capsid protein (ii). among all the proteins expressed, VP9 was obtained in high amount and showed the highest immuno-reactivity[ncbi.nlm.nih.gov] Autographa californica multiple nucleopolyhedrovirus I Granulovirus Cydia pomonella granulovirus I Nimaviridae Whispovirus White spot syndrome virus 1 I Herpesviridae Alphaherpesvirinae[jams.med.or.jp]

    Missing: 38 kDa
  • Oldenlandiae

    ; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Bombycoidea; Sphingidae; Macroglossinae; Macroglossini; Theretra Known viruses (1) Scientific Name Clanis bilineata nucleopolyhedrovirus[genome.jp] […] aminotransferase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP), gamma-glutamyltranspeptidase (GGT), bilirubin (BIL), blood urea nitrogen (BUN), total protein[chinesemedicaldiabetes.com] Andrographis / Chuan Xin Lian (CLS-11285) 9.90 USD Andrographis Compound / Chuan Xin Lian Kang Tang (CHF-10142) 9.90 USD Anemarrhena Root / Zhi Mu (CLS-12680) 9.90 USD Anemopsis californica[goldenlotusherbs.com] Literature Reference PMID: 19243590 Authors Zhu SY, Yi JP, Shen WD, Wang LQ, He HG, Wang Y, Li B, Wang WB Title Genomic sequence, organization and characteristics of a new nucleopolyhedrovirus[genome.jp]

    Missing: 38 kDa Autographa
  • Morganella Morganii

    An examination of the outer membrane proteins showed a lack of a 38-kDa outer membrane protein (OMP) compared with M. morganii susceptible to carbapenems.[ncbi.nlm.nih.gov] […] of cell lysates by sodium dodecyl sulphate-discontinuous polyacrylamide gel electrophoresis, strains could be differentiated into 21 types on the basis of outer membrane proteins[ncbi.nlm.nih.gov] The protein patterns, which contained 45 to 50 discrete bands, were highly reproducible.[ncbi.nlm.nih.gov] RESULTS: The 3,826,919-bp sequence contained in 58 contigs has a GC content of 51.15% and includes 3,565 protein-coding sequences, 72 tRNA genes, and 10 rRNA genes.[ncbi.nlm.nih.gov] In the first, which included all the protein bands, the M. morganii strains formed 21 clusters at the 91% S level.[ncbi.nlm.nih.gov]

    Missing: Autographa californica nucleopolyhedrovirus
  • Toxoplasma Gondii

    IgG in saliva was detected by 27 days post infection (p.i.) and was negative by 81 days p.i.; it detected mainly the 38 and 30 kDa antigens.[ncbi.nlm.nih.gov] KEYWORDS: Host-pathogen interaction; Protein-protein interaction; Tg14–3-3; Toxoplasma gondii; Yeast two-hybrid system[ncbi.nlm.nih.gov] CONCLUSIONS: Homo sapiens zinc finger protein was found to interact with SAG2.[ncbi.nlm.nih.gov] We expressed a functional recombinant TgTCTP (r TgTCTP) protein in Escherichia coli and found that the recombinant protein could form a multimer.[ncbi.nlm.nih.gov] Twenty of the 27 saliva samples were positive for IgG antibody on toxoplasma immunoblots with three major immunodominant antigens; 38, 30 and 35 kDa.[ncbi.nlm.nih.gov]

    Missing: Autographa californica nucleopolyhedrovirus
  • Werner Syndrome

    kDa including tags Amino acids 1322 to 1432 Our Abpromise guarantee covers the use of ab112372 in the following tested applications.[abcam.com] After certain DNA-damaging treatments, WRN is recruited to sites of blocked replication and co-localizes with the human single-stranded DNA-binding protein replication protein[ncbi.nlm.nih.gov] We raise the possibility that in addition to its enzymatic activities WRN may act as a scaffold for the assembly on DNA of additional DNA processing proteins.[ncbi.nlm.nih.gov] Conclusions Our results suggest that: 1) reduced rates of protein synthesis is unlikely the result of a stress response; 2) Alteration in protein synthesis are likely contributing[oncologypro.esmo.org] Sequence Accession Species Human Sequence NPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNK RRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKL MDKTKRGGLFS Molecular weight 38[abcam.com]

    Missing: Autographa californica nucleopolyhedrovirus
  • Rickettsia Rickettsii

    Here we report the 2.2 Å crystal structure of the conserved N-terminal 38 kDa domain of sca4 from Rickettsia rickettsii. The structure reveals two subdomains.[rcsb.org] No difference in rickettsial ultrastructure or protein profiles was detected between different host cell types.[ncbi.nlm.nih.gov] Abstract Neuronal Wiskott-Aldrich syndrome protein (N-WASP) and the actin-related protein 2/3 (Arp2/3) complex have emerged as critical host proteins that regulate pathogen[ncbi.nlm.nih.gov] These annotated proteins were further classified into 88 enzymes, 59 transport and membrane proteins, 35 binding proteins, 12 structural motifs and the rest of the protein[eurekaselect.com] To model differences in host-parasite interaction, R. rickettsii growth and protein expression were examined at temperatures reflective of host environment in the tick cell[ncbi.nlm.nih.gov]

    Missing: Autographa californica nucleopolyhedrovirus
  • Teucrium

    […] the most of this Mediterranean native’s silvery foliage by pairing it with plants that have dark foliage and similar growing needs, such as Baja fairy duster ( Calliandra californica[houzz.com] […] oxidation markers including protein carbonyl formation (PCO) and loss of protein thiols.[ncbi.nlm.nih.gov] Interestingly, sublethal concentrations of T persicum extract induced an epithelial-like morphology in a subpopulation of cells with an increase in E-Cadherin and β-Catenin protein[ncbi.nlm.nih.gov] Furthermore, the same extract exhibited prooxidant behaviour at protein level and induce formation of reactive oxygen species in human laryngeal carcinoma cells causing cytotoxic[ncbi.nlm.nih.gov] Abstract Regarding the involvement of free radicals and oxidative reactions in protein glycoxidation processes, compounds with antioxidant activities have been tested in order[ncbi.nlm.nih.gov]

    Missing: 38 kDa Autographa nucleopolyhedrovirus
  • Fasciola Gigantica

    The finding suggests that the 38 kDa components may be a potential diagnostic antigen for fascioliasis.[ncbi.nlm.nih.gov] Abstract A cDNA containing a 813 bp open reading frame encoding vitelline protein BI (FgVPBI) of Fasciola gigantica was cloned.[ncbi.nlm.nih.gov] In the first group were found 60 and 38 kDa proteins; in the second group were found 66, 60, and 38 kDa proteins.[ncbi.nlm.nih.gov] These antigenic components had a molecular mass ranging from less than 14.4 to 38 kDa.[ncbi.nlm.nih.gov] […] analysis* Fatty Acid-Binding Proteins/chemistry Fatty Acid-Binding Proteins/immunology Fatty Acid-Binding Proteins/isolation & purification Feces/parasitology Horseradish[ncbi.nlm.nih.gov]

    Missing: Autographa californica nucleopolyhedrovirus
  • Streptococcus Sanguis

    A band at 38 kDa reacted with MAb 1.1 whereas a band at 54 kDa reacted with MAb 1.2 in Western blot analysis, indicating two distinct adhesive epitopes on the 150-kDa antigen[ncbi.nlm.nih.gov] In contrast, both antisera reacted equally strongly with cell-free extracts of the remaining two clones (encoding dihydrofolate synthase and an unknown protein).[ncbi.nlm.nih.gov] […] by isolating heat shock proteins from streptococci.[ncbi.nlm.nih.gov] This platelet aggregation-associated protein (PAAP) contains a collagen-like, platelet-interactive domain within a 23-kDa protein fragment.[ncbi.nlm.nih.gov] Additivity experiments suggested the distinct epitopes were in three groups: (i) 36/56 kDa, (ii) 87/150 kDa, and (iii) 100/130/170 kDa.[ncbi.nlm.nih.gov]

    Missing: Autographa californica nucleopolyhedrovirus