Create issue ticket

90 Possible Causes for ASSAY, Concentration:Point, Deprecated, Protein, S:Arbitrary, IN, time:Plasma:Quantitative:COAGULATION

  • Upper Respiratory Infection

    Diseases, Mayo Clinic, 200 First Street SW, Rochester, MN 55905, USA. [email protected] Abstract We evaluated a commercial multiplex polymerase chain reaction (PCR) assay[ncbi.nlm.nih.gov] In addition, all guidelines consistently deprecated decongestants, antihistamine and systemic corticosteroids (not local corticosteroids) in pediatric ABRS.[journals.plos.org] The large range of measurable levels for s-IgA at the different time points for athletes and controls and the lack of relationship between s-IgA levels and TSDs indicate that[ncbi.nlm.nih.gov] */genetics Receptors, G-Protein-Coupled*/immunology Receptors, G-Protein-Coupled*/metabolism Rhinitis*/genetics Rhinitis*/immunology Rhinitis*/metabolism Rhinitis*/microbiology[ncbi.nlm.nih.gov] However, such limits are biologically arbitrary.[doi.org] […] onset were studied for viruses by conventional and molecular techniques, and for concentrations of IL-1beta, IL-6, and TNFalpha by multiplex enzyme-linked immunosorbent assay[ncbi.nlm.nih.gov] […] of study time point.[doi.org]

    Missing: IN
  • Saccharomyces Cerevisiae

    Assays to Monitor Autophagy in Saccharomyces cerevisiae . Cells 2017 , 6 , 23.[mdpi.com] New genes and other chromosomal features have been identified and added to the annotation, whereas others have been changed or deprecated ( Fisk et al. 2006 ).[g3journal.org] Pointing to new mechanisms of acetylation-phosphorylation cross-talk, RTS1 high-copy rescue of gcn5 growth requires two residues of H2B that are phosphorylated in human cells[ncbi.nlm.nih.gov] […] machinery, especially the protein secretory pathway.[ncbi.nlm.nih.gov] Responder status was defined as a subject who experienced a decrease of 1 arbitrary unit (a.u.) or 50% of the abdominal discomfort score from baseline for at least 2 wk out[ncbi.nlm.nih.gov] […] anchored to loop I of U5 small nuclear RNA, and the conserved AG nucleotides of the 3'-splice site (3'SS) are specifically recognized by the invariant adenine of the branch point[ncbi.nlm.nih.gov] The enzyme showed an isoelectric point of 4.5 and maximum activity at 46 C and pH 7.2, retaining 92% of the activity at 37 C.[ncbi.nlm.nih.gov]

    Missing: IN
  • Lactococcus Lactis

    A single-cell tracking and rotation assay for a single flagellum showed that the swimming behaviour of Salmonella was severely but transiently impaired through disruption[ncbi.nlm.nih.gov] Name Ids '20018168-6c66-4636-a12b-d0d5b7578dcc' was deprecated on 8-Sep-2016 Scientific Name Authority (Lister 1873) Schleifer et al.[nzor.org.nz] A sensory evaluation resulted as the overall general acceptability of bhatura to be 4.91 0.03 on a five-point hedonic scale.[ncbi.nlm.nih.gov] KEYWORDS: protein nanoparticles; recombinant proteins; tumor-homing peptides [Indexed for MEDLINE] Free full text[ncbi.nlm.nih.gov] Genetic diversity among dairy lactococcal strains investigated by polymerase chain reaction with three arbitrary primers. J. Appl. Microbiol. 86 : 514 -520. Mori, S., K.[doi.org] […] known to contain transmission blocking epitopes, 6C and C0, respectively, were produced in a Lactococcus lactis expression system and used in enzyme linked immunosorbent assays[ncbi.nlm.nih.gov] Genome resequencing, revealed six, seven, and 28 mutations in the three strains, including point mutations in loci related to amino acid biosynthesis and transport and in[ncbi.nlm.nih.gov]

    Missing: IN
  • Paroxysmal Nocturnal Hemoglobinuria

    In this multicenter study, we have validated a simplified, one-tube two-color FLAER-based assay suitable for PNH screening.[ncbi.nlm.nih.gov] Abstract Chronic idiopathic neutropenia (CIN) is an acquired disorder of granulopoiesis characterized by increased apoptosis of the bone marrow (BM) granulocytic progenitor[ncbi.nlm.nih.gov] RESULTS: Consensus was reached for 95% of screening and diagnostic decision points and 90% of tests required at decision points.[ncbi.nlm.nih.gov] […] genetics Membrane Proteins/immunology* Mutation Substances CD59 Antigens Membrane Proteins phosphatidylinositol glycan-class A protein CD59 protein, human Supplementary concept[ncbi.nlm.nih.gov] Warfarin prophylaxis was recommended to patients with granulocyte PNH clone sizes larger than 50% (a cut-off that was somewhat arbitrary but seems to identify those patients[doi.org] […] group the mean score decreased by 4.0 1.7 points during this period, for a total difference between the two groups of 10.4 points ( Figure 3 ).[nejm.org] The hemostatic status of three patients with PNH was assessed during eculizumab treatment by D-dimer assay and the global assays: thromboelastography (TEG), thrombin generation[ncbi.nlm.nih.gov]

    Missing: Deprecated
  • Streptococcus Mutans

    The inheritability assay, minimum inhibitory concentration (MIC) and live/dead biofilm assay were determined to investigate persister characteristics.[ncbi.nlm.nih.gov] Name Ids '0fa40dd2-6939-43ef-b0a5-9467ef910be9' was deprecated on 14-Sep-2018 Scientific Name Authority Clarke Rank species Year 1924 Governing Code ICNB Is Recombination[nzor.org.nz] Forty-nine point mutations were identified in scrA from the 60 clinical isolates.[ncbi.nlm.nih.gov] Recently, bacterial DNA encoding 120-kDa cell surface collagen-binding proteins (CBPs) has frequently been detected from S. mutans -positive IE patients.[ncbi.nlm.nih.gov] METHODS: Streptococcus mutans strains were isolated from supragingival biofilm samples of CF, ECC and severe-ECC (S-ECC) children and genotyped by arbitrary-primer polymerase[ncbi.nlm.nih.gov] Evaluation of genotypic diversity of Streptococcus mutans using distinct arbitrary primer. J Appl Oral Sci. 2008 Nov-Dec; 16(6): 403-7. 29.[revistas.javeriana.edu.co] Quantitative assessment of the developed biofilm should be further performed by applying an optical profilometry assay, and by testing the effect on both surface roughness[ncbi.nlm.nih.gov]

    Missing: IN
  • Streptococcus Lactis

    A single-cell tracking and rotation assay for a single flagellum showed that the swimming behaviour of Salmonella was severely but transiently impaired through disruption[doi.org] Name Ids '20018168-6c66-4636-a12b-d0d5b7578dcc' was deprecated on 8-Sep-2016 Scientific Name Authority (Lister 1873) Schleifer et al.[nzor.org.nz] End-point age for survival in these mice was approximately 75 weeks.[ncbi.nlm.nih.gov] Clusters 3,026 3,026 Identical Protein Groups 123,185 89,327 Bio Project 185 57 Bio Sample 577 254 Bio Systems 2,241 178 Assembly 195 63 Probe 21 9 PubChem BioAssay 33 30[ncbi.nlm.nih.gov] Genetic diversity among dairy lactococcal strains investigated by polymerase chain reaction with three arbitrary primers. J. Appl. Microbiol. 86 : 514 -520. Mori, S., K.[doi.org] Cell sensitivity assays: the MTT assay. Meth Mol Biol. 2011;731:237–45.[doi.org] Genome resequencing, revealed six, seven, and 28 mutations in the three strains, including point mutations in loci related to amino acid biosynthesis and transport and in[doi.org]

    Missing: IN
  • Listeria Monocytogenes

    Supernatant obtained from L. monocytogenes strain suspension was reactive with GM-assay.[ncbi.nlm.nih.gov] Name Ids '740eb473-328d-4aec-8d10-58e552f250cc' was deprecated on 8-Sep-2016 Scientific Name Authority (Murray et al. 1926) Pirie Rank species Year 1940 Governing Code ICNB[nzor.org.nz] Now we knew the L indirect at each time point.[ncbi.nlm.nih.gov] IMPORTANCE: The promyelocytic leukemia protein (PML) is a eukaryotic protein that can polymerize in discrete nuclear assemblies known as PML nuclear bodies (NBs) and plays[ncbi.nlm.nih.gov] In addition, the use of genetic or phenotypic features to circumscribe new species in the absence of an evolutionary framework for interpreting species boundaries is arbitrary[doi.org] This allows readers to interpret the data without being limited to a binary classification around an arbitrary threshold for significance ( 34 ).[doi.org] The standard disk diffusion method and minimum inhibitory concentration (MIC) assay were used for antimicrobial susceptibility testing and multiplex PCR for serotyping.[ncbi.nlm.nih.gov]

    Missing: IN
  • Deafness, Autosomal Recessive, Type DFNB1A

    Quality control assays assessing reproducibility identified the intra-assay CV (%) and inter-assay CV(%).[mybiosource.com] DEPRECATED Concept is deprecated. Concept should not be used, but it is retained in LOINC for historical purposes.[hipaaspace.com] A point of maximal displacement of the basilar membrane is determined by the frequency of the stimulating tone.[accesspharmacy.mhmedical.com] Product name Protein length Full length protein Nature Recombinant Source Wheat germ Amino Acid Sequence Accession Species Human Sequence MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQAD[abcam.com] References "Transcriptional downregulation of gap-junction proteins blocksjunctional communication in human mammary tumor cell lines."[genscript.com] One Step Rapid Immunochromotographic Assay) 3 1180.00 Jo-1 ( ( ), ( ) (Anti-Jo-1, Dermatomyositis, DM, Polymyositis, PM) 6 575.00 La/SS-B (Anti-La/SS-B) 6 575.00 : - (RH factor[e1.ru] ., point in time vs 24 hours) System BLD/TISS Fourth major axis-type of specimen or system (e.g., serum vs urine) Scale Type DOC Fifth major axis-scale of measurement (e.g[hipaaspace.com]

    Missing: IN
  • Recurrent Infection due to Specific Granule Deficiency

    RBC adenosine deaminase assay Severe lymphopenia Levels are low in a specific form of SCID.[merckmanuals.com] Chronic benign neutropenia, chronic idiopathic neutropenia and autoimmune neutropenia are very similar in laboratory findings and differ only with regards to age of onset[europeanmedical.info] In these age groups, the serum Ig level reaches its lowest point (approximately 350mg/dl), and many normal infants begin to experience recurrent respiratory tract infections[hawaii.edu] Genetics and Cytogenetics in Oncology and Haematology: CEBPE No data available for UniProtKB/Swiss-Prot and Genatlas for CEBPE Gene A novel human CCAAT/enhancer binding protein[genecards.org] Figure 6 shows a schematic representation of these combined T and B cell defects portrayed according to this arbitrary classification. Figure 6.[immunopaedia.org.za] Thus, the ΔRS likely impairs protein-protein interaction with other transcription factors, resulting in a loss of transcriptional activation.[ncbi.nlm.nih.gov] Infectious Complications In Children With Severe Congenital, Autoimmune Or Idiopathic Neutropenia: A Retrospective Study From The Italian Neutropenia Registry.[emedicine.medscape.com]

    Missing: Deprecated
  • Immunodeficiency due to Ficolin 3 Deficiency

    Master all the latest approaches in clinical laboratory medicine with new and updated coverage of: the chemical basis for analyte assays and common interferences; lipids and[books.google.com] Neutropenia IDP064 Idiopathic Recurrent Pericarditis IDP041 Idiopathic Scoliosis IDP070 Idiopathic Steroid-Sensitive Nephrotic Syndrome with Diffuse Mesangial Proliferation[malacards.org] The 3 pathways (CAM) converge at the point of cleavage of C3. Then C3b becomes an acceptor site for C5, and C5-9 form the membrane attacking complex (MAC).[allergynotes.blogspot.com] […] with FCN3 recombinant protein[mybiosource.com] 374-1 classifies the most prevalent PIDs according to this manner of classification; however, one should bear in mind that the classification of PIDs sometimes involves arbitrary[accessmedicine.mhmedical.com] The performance characteristics of this assay have not been established by the manufacturer.[labcorp.com] […] gene orthology) HPO (phenotypes) Mouse Models phenotype-based associations Disease phenotypes are compared with mouse phenotypes, with each mouse model contributing one point[mousephenotype.org]

    Missing: Deprecated