Create issue ticket

11,171 Possible Causes for DAP12,, human, immunoreceptor

Show results in: 日本語

  • Myelodysplasia

    […] early forced maturation of MDSC by either all-trans-retinoic acid treatment or active immunoreceptor tyrosine-based activation motif–bearing (ITAM-bearing) adapter protein (DAP12[ncbi.nlm.nih.gov] Author information 1 Section of Hematology, Yale Comprehensive Cancer Center and Department of Internal Medicine, Yale University School of Medicine, New Haven, CT; and. 2 Human[ncbi.nlm.nih.gov] , Pair 3/genetics* Chromosomes, Human, Pair 5/genetics* Humans Leukemia, Myelomonocytic, Juvenile/genetics* Leukemia, Myelomonocytic, Juvenile/pathology* Male Translocation[ncbi.nlm.nih.gov]

  • Interleukin-2

    DAP12 signaling, organism-specific biosystem (from REACTOME) DAP12 signaling, organism-specific biosystem In response to receptor ligation, the tyrosine residues in DAP12'[ncbi.nlm.nih.gov] […] recombinant human IL-2 WHO International Standard (NIBSC code: 86/500).[shenandoah-bt.com] Human IL2 kit - 1 x 96 tests 62HIL02PET pdf - Companion products Description Cat. no Product insert MSDS Human IL2 kit - 3 Standards 62HIL02CD3 - - Human IL2 kit - Standard[cisbio.com]

  • Presenile Dementia With Bone Cysts

    Interestingly, significant DAP12 expression was found in numerous microglia in one NHD case with a homozygous DAP12 single-base substitution, and both real-time PCR and Western[springermedizin.de] Product name Protein length Full length protein Nature Recombinant Source Wheat germ Amino Acid Sequence Accession Species Human Sequence GLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR[abcam.com] An activating immunoreceptor complex formed by NKG2D and DAP10 . Science 258 , 730–732 (1999). 12. Chang, C.W. et al.[nature.com]

  • Human Herpesvirus 8

    BACKGROUND: Oral human papillomavirus (HPV) and human herpesvirus-8 (HHV8) infections are sexually transmitted and respectively associated with the development of oropharyngeal[ncbi.nlm.nih.gov] The K1 gene of HHV-8 is expressed in tumor cells as a transmembrane protein with an immunoglobulin-like domain in its ectodomain and an immunoreceptor tyrosine-based activation[cancerres.aacrjournals.org] BACKGROUND: The purpose of this study was to verify a possible co-infection of human herpesvirus 8 (HHV-8) in commonly associated human papillomavirus (HPV) penile lesions[ncbi.nlm.nih.gov]

    Missing: DAP12
  • Bombyx

    To elucidate the functional abnormalities of mutant-type DAP12, we expressed wild-type and mutant-type recombinant DAP12 protein with Bombyx mori nucleopolyhedrovirus (BmNPV[ncbi.nlm.nih.gov] The B. mori carotenoid transport system is useful in human studies.[ncbi.nlm.nih.gov] Similar results were obtained using primary cultures of human RPE cells, but cultures took noticeably longer to establish on BMSF compared with tissue culture plastic.[ncbi.nlm.nih.gov]

    Missing: immunoreceptor
  • Acute Gastroenteritis

    Costs and potential cost savings for the healthcare system should be considered when designing sectorial and cross-sectorial interventions to reduce the burden of human campylobacteriosis[ncbi.nlm.nih.gov] KEYWORDS: Acute gastroenteritis; clinical features; genotypes; human parechoviruses; prevalence[ncbi.nlm.nih.gov] Human bocavirus (HBoV) is a newly described virus associated with gastroenteritis.[ncbi.nlm.nih.gov]

    Missing: DAP12 immunoreceptor
  • Diffuse Intrinsic Pontine Glioma

    Tumor Suppressor Protein p53 PIK3R1 protein, human Phosphatidylinositol 3-Kinases ACVR1 protein, human Activin Receptors, Type I PPM1D protein, human Phosphoprotein Phosphatases[ncbi.nlm.nih.gov] […] domain-containing-3, programmed cell death-1 (PD-1), programmed cell death ligand-1 (PD-L1), V-domain immunoglobulin suppressor of T cells activation, T cell immunoglobulin and immunoreceptor[ncbi.nlm.nih.gov] NG2 expression is altered (symmetric segregation) in mitotic human DIPG and mouse tumor cells.[ncbi.nlm.nih.gov]

    Missing: DAP12
  • Moraxella Catarrhalis

    In particular, human beta-defensin 3 (hBD-3) exerts an antimicrobial effect against an extraordinarily broad spectrum of pathogens.[ncbi.nlm.nih.gov] KEYWORDS: CARD9; CEACAM3; COPD; Moraxella catarrhalis; Syk; granulocyte; immunoreceptor tyrosine-based activation motif (ITAM)[ncbi.nlm.nih.gov] […] accessible in the upper respiratory tract, against two human-specific respiratory pathogens.[ncbi.nlm.nih.gov]

    Missing: DAP12
  • B-Cell Chronic Lymphocytic Leukemia

    We have developed a protocol to expand Vδ1 and Vδ2 preferentially from human blood. We have characterized these subsets and their specificities for leukemic targets.[ncbi.nlm.nih.gov] In this study, we demonstrate that Lyn constitutively phosphorylates the immunoreceptor tyrosine inhibitory motifs of the inhibitory cell surface co-receptor CD5, a marker[ncbi.nlm.nih.gov] […] several human, solid transplantable cancers.[ncbi.nlm.nih.gov]

    Missing: DAP12
  • Influenza

    […] can act as antigenic archives of human influenza viruses, raising the risk of reemergence in humans when sufficient susceptible populations arise.[ncbi.nlm.nih.gov] Waning serological responsiveness to influenza vaccination with the progression of human pregnancy has important translational implications for when immunization should be[ncbi.nlm.nih.gov] Abstract Avian influenza virus (AIV) can directly cross species barriers and infect humans with high fatality.[ncbi.nlm.nih.gov]

    Missing: DAP12 immunoreceptor