Create issue ticket

33 Possible Causes for E2f4, mouse, protein

Show results in: 日本語

  • Diffuse Gastric Cancer

    An E-cadherin/p53 double-conditional knockout (DCKO) mouse line recapitulates human DGC morphologically and molecularly.[ncbi.nlm.nih.gov] Our results disclose important proteins such as apolipoprotein B-100, S100 and 14-3-3 proteins, among many others, highlighting the different pathways enriched by each cancer[ncbi.nlm.nih.gov] […] pRb2/p130 is a key tumor suppressor, whose oncosuppressive activity has mainly been attributed to its ability to negatively regulate cell cycle by interacting with the E2F4[ncbi.nlm.nih.gov]

  • Retinoblastoma

    KEYWORDS: cancer cell of origin; cone photoreceptor; genetically engineered mouse models; retinoblastoma; retinoma[ncbi.nlm.nih.gov] A C-terminal LxCxE motif in ORFV119 enabled the protein to interact with the retinoblastoma protein (pRb) a multifunctional protein best known for its tumor suppressor activity[ncbi.nlm.nih.gov] Interacts with heterodimeric E2F/DP transcription factor complexes containing TFDP1 and either E2F1, E2F3, E2F4 or E2F5, or TFDP2 and E2F4.[uniprot.org]

  • Liver Metastasis

    Gemcitabine increased inflammatory cytokines including TIMP1 in the KPC mouse model.[ncbi.nlm.nih.gov] ARC protein).[ncbi.nlm.nih.gov] E2F4 and CDX2), microRNAs (e.g. miR-590-3p and miR-203) and lncRNAs (e.g. lincIRX5 and lincFOXF1) that may play an important role in the process of colorectal cancer liver[ncbi.nlm.nih.gov]

  • Dexamethasone

    The current study aimed therefore to investigate the effects of an endothelial targeted delivery of dexamethasone in a mouse model of endotoxemia induced by two consecutive[ncbi.nlm.nih.gov] Thirty-four proteins were defined out of a total of 746 63.[ncbi.nlm.nih.gov] TFs ATF2 and E2F4 and miRNA miR-16 were predicted for the DEGs.[ncbi.nlm.nih.gov]

  • Turcot Syndrome

    Models phenotype-based associations Disease phenotypes are compared with mouse phenotypes, with each mouse model contributing one point to the diagram.[mousephenotype.org] Product name Protein length Full length protein Nature Recombinant Source Wheat germ Amino Acid Sequence Species Human Sequence MFAEMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQ[abcam.com] Alteration at repeated sequences in the coding regions were 72% at TGFbetaRII(A)10, 24% at IGFIIR(G)8, 45% at BAX(G)8, 55% at E2F4(CAG)13, 66% at caspase-5 (A)10, 31% at MBD4[ncbi.nlm.nih.gov]

  • Arsenic Trioxide

    A NB4/SCID mouse model was established in this study.[ncbi.nlm.nih.gov] Abstract Signal regulatory protein α (SIRPα) has been shown to operate as a negative regulator in cancer cell survival.[ncbi.nlm.nih.gov] Isoform PML-4 also: acts as a transcriptional repressor of TBX2 during cellular senescence and the repression is dependent on a functional RBL2/E2F4 repressor complex, regulates[drugbank.ca]

  • Adenovirus Infection

    Remarkably, whereas the expression of HAdV genes was low in p53-deficient mouse embryonic fibroblasts (p53KO MEFs), the HAdV early gene products were efficiently expressed[ncbi.nlm.nih.gov] We identified 5937 proteins, and of these, 69 and 58 proteins were down-regulated during wild-type and E1B-55k (dl1520) adenovirus infection, respectively.[ncbi.nlm.nih.gov] About this article Publication history Published 21 November 2005 DOI Further reading Multicilin and activated E2f4 induce multiciliated cell differentiation in primary fibroblasts[nature.com]

  • Lymph Node Metastasis

    After sequential administration of IRDye800-antibodies intravenously and Cy5.5-HA locally to a mouse model with LN metastases and fluorescence optical imaging, partially metastasized[thno.org] However, we found no significant association between positive rate of PTEN protein and LNM among Asians and Caucasians (both P 0.05).[ncbi.nlm.nih.gov] The top upstream regulators of our genes of interest are PTGER2, ERBB2, E2F4 , and TGFB1 ( Supplementary Table 3 ).[nature.com]

  • Spinocerebellar Ataxia Type 4

    , Rat Applications WB, Simple Western, ELISA NB120-3446 Rabbit Polyclonal Species Human, Mouse, Rat Applications WB, ChIP, GS Alternate Names Spinocerebellar Ataxia Type 4[novusbio.com] Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins.[string-db.org] OCe07275 E2F4 Canis lupus familiaris E2F transcription factor 4, p107/p130-binding (E2F4), mRNA.[genscript.com]

  • Follicular Dendritic Cell Sarcoma

    In the present study, a patient-derived orthotopic xenograft (PDOX) mouse model of FDCS was established in the biceps muscle of nude mice.[ncbi.nlm.nih.gov] In 2 of the 4 cases, p16 expression corresponded to loss of retinoblastoma protein expression.[ncbi.nlm.nih.gov] CNPASA COLAGENO II COLAGENO IV COX 2 CROMOGRANINA A CTLA-4/CD152 CXCL13 CYTOKERATIN OSCAR DESMINA DESMINA RMab DESMOGLEINA-3 DESMOGLEINA-3 RMab DIGOXIGENINA DOG1 DOG1 RMab E2F4[docplayer.net]