Create issue ticket

26 Possible Causes for Ql, Scn, TCT, Ur

Show results in: 日本語

  • Candida Albicans

    Identities 38/80 (47%), Positives 49/80 (61%), Gaps 2/80 (2%) Query: 145 MAIEYFHNSS--GVQTYLANKLFSFPHEDVDFYLPQLATMYIELADVAEVLKPYLIHRCK 202 M I Y S VQ YLA LF FP DVDFYL QL Y[kaikogaas.dna.affrc.go.jp] Primer Sequence (5′–3′) β-actin S TCA CCC A CA CTG TGC CCA TCT ACG A β-actin AS CAG GGG AAC CGC TCA TTG CCA ATG TNF-α S TGG GAG TAG ACA AGG TAC AAC CC TNF-α AS CAT CTT CTC[doi.org] Download 4 Transcript International Journal of Antimicrobial Agents 43 (2014) 78 81Contents lists available at ScienceDirectInternational Journal of Antimicrobial Agentsj o ur[myslide.es] […] proportion of Candida species iso-red to all the bloodstream infections over the years ofspecies frequency ranked sixth in the non-ICU iso-negative coagulase staphylococci -SCN[dokumen.tips]

  • Entrapment Neuropathy

    I released the QL; I did visceral to the kidney. The SI was unstable; I addressed that and she did four sessions of prolotherapy to the lumbosacral and SI area.[dynamicchiropractic.com] -Pain btwn met heads is characterized as burning, stabbing, tingling, or electric & *radiates out into the toes - Pain aggravated by activity and tight fitting shoes bc ur[quizlet.com] […] surgery for SCN entrapment.[ncbi.nlm.nih.gov] OBJECT: Superior cluneal nerve (SCN) entrapment neuropathy is a poorly understood clinical entity that can produce low-back pain.[ncbi.nlm.nih.gov]

    Missing: TCT
  • NADH Cytochrome B5 Reductase Deficiency

    When K 2, the QL population was distinct from the three southern populations.[journals.plos.org] Exon Primer pair Ta Enzyme PCR Normal MutantM127V 5 CCT GGA GCT GGG GAC TGA GG (s)GTG TAA CCA AGG GAT TCC GAC CCG (as)62 BsaXI 200 200 30, 69,101A179T 6 CCG GGC CTC ACC CCT TCT[vdocuments.site] SN - 0001-5792 UR - L2 - DB - PRIME DP - Unbound Medicine ER -[unboundmedicine.com] In a patient with type I1 (generalized), a substitution of cy- tosine for thymine ( 127 TCT-CCT: serine to proline) was reported at codon 127 in exon 5 of the gene [ 18).[vdocuments.mx]

    Missing: Scn
  • Aripiprazole

    Effectiveness measures included change from baseline in health-related qualify of life and functioning on the Heinrichs-Carpenter Quality of Life scale (QLS) and Clinical[ncbi.nlm.nih.gov] Urs Meyer , Developmental neuroinflammation and schizophrenia , Progress in Neuro-Psychopharmacology and Biological Psychiatry , 42 , (20) , (2013) .[doi.org] Splitting of the behavioural activity phase has been found in nocturnal rodents with suprachiasmatic nucleus (SCN) coupling disorder.[ncbi.nlm.nih.gov] Claudia Pisanu, Donatella Congiu, Marta Costa, Caterina Chillotti, Raffaella Ardau, Giovanni Severino, Andrea Angius, Urs Heilbronner, Liping Hou, Francis J.[doi.org]

    Missing: TCT
  • Cystic Fibrosis

    […] to find positive effects of inpatient rehabilitation on the patients' QL.[doi.org] Najeeb-ur-Rehman, Samra Bashir, Adnan J.[doi.org] Vol 46, No 2 (2008) ORIGINAL PAPERS Published online: 2008-06-04 Submitted: 2011-12-19 Abstract Thiocyanates (SCN-) are ubiquitous in nature.[doi.org] Thiocyanates (SCN-) are ubiquitous in nature. There are indispensable part of host defense system that act as a substrate for lactoperoxidase (LPO).[ncbi.nlm.nih.gov]

    Missing: TCT
  • Cryptogenic Cirrhosis

    Choo QL, Kuo G, Weiner AJ, Overby LR, Bradley DW, Houghton M. Isolation of a cDNA clone derived from a blood-borne non-A, non-B viral hepatitis genome.[tropicalgastro.com] […] milliliters of the extract were amplified using the specific primers in which the sense oligonucleotide (Fw) was labeled with biotin for subsequent use in pyrosequencing (Fw [BIO] TCT[journals.plos.org] SN - 0004-5772 UR - L2 - DB - PRIME DP - Unbound Medicine ER -[unboundmedicine.com] UR - UR - M3 - Article VL - 176 SP - 1491 EP - 1495 JO - Journal of Infectious Diseases JF - Journal of Infectious Diseases SN - 0022-1899 IS - 6 ER -[mayoclinic.pure.elsevier.com]

    Missing: Scn
  • Acute Leukemia

    Zhang R 1 , Shi W 1 , Wang HF 1 , You Y 1 , Zhong ZD 1 , Li WM 1 , Zhang C 1 , Lu X 1 , Wang YD 1 , Zheng P 1 , Fang J 1 , Hong M 1 , Wu QL 1 , Xia LH 1 .[ncbi.nlm.nih.gov] View Article PubMed Google Scholar Henderson M, Choi S, Beesley AH, Sutton R, Venn NC, Marshall GM, Kees UR, Haber M, Norris MD: Mechanism of relapse in pediatric acute lymphoblastic[casesjournal.biomedcentral.com] ), revealing their unmet SCNs.[ncbi.nlm.nih.gov] PURPOSE: To understand the supportive care needs (SCNs), with associated influencing factors, related to five unmet need dimensions in adult Acute Leukemia (AL) patients,[ncbi.nlm.nih.gov]

    Missing: TCT
  • Vitamin E

    Author Contributions Performed the experiments: RC Z-QL QX. Analyzed the data: RC Z-QL QX. Contributed reagents/materials/analysis tools: RC Z-QL.[doi.org] Stock solution of TCT supplement solution (0.06 g TCT per ml) was made in vitamin E-stripped corn oil.[doi.org] Bran GM, Goessler UR, Hormann K, Riedel F, Sadick H (2009) Keloids: current concepts of pathogenesis (review). Int J Mol Med 24(3):283–293 PubMed Google Scholar 17.[doi.org] Novel ur nary metabolite of alpha-tocopherol, 2,5,7,8-tetramethyl-2(2 ′-carboxyethyl)-6-hydroxychroman, as an indicator of an adequate vitamin E supply?[nap.edu]

    Missing: Scn
  • Klebsiella

    An QL, Yang XJ, Dong YM, Feng LJ, Kuang BJ, et al. (2001) Using confocal laser scanning microscope to visualize the infection of rice roots by GFP-labelled Klebsiella oxytoca[doi.org] ., 2005) : rpoB : F : Vic3 5'-GGC GAA ATG GCW GAG AAC CA-3' rpoB : R : Vic2 5'- GAG TCT TCG AAG TTG TAA CC-3' gapA : F : 173 5'-TGA AAT ATG ACT CCA CTC ACG G-3' gapA : R :[pubmlst.org] Y1 - 2016/10/13/ BT - Johns Hopkins ABX Guide UR - PB - The Johns Hopkins University DB - Johns Hopkins Guide DP - Unbound Medicine ER -[hopkinsguides.com] 24 P4 Penicillin 25 RAF Raffinose 26 RHA Rhamnose 27 SOR Sorbitol 28 SUC Sucrose 29 TAR Tartarate – – – – 30 TDA Tryptophan Deaminase – – – – – – – – 31 TO4 Tobramycin 32 URE[trivedieffect.com]

    Missing: Scn
  • Pancytopenia - Developmental Delay Syndrome

    J Pediatr. 1989; 115 :108–10. [ PubMed : 2738778 ] Huang J, Deng Q, Wang Q, Li KY, Dai JH, Li N, Zhu ZD, Zhou B, Liu XY, Liu RF, Fei QL, Chen H, Cai B, Zhou B, Xiao HS, Qin[ncbi.nlm.nih.gov] Cause of death (n 3) 1 2 3 Age at SCT 15y 2y 1y Donor Mismatched R-PB Mismatched UR-CB Mismatched UR-CB MEL dose 80 mg 70 mg 70 mg ATG etc.[slideshare.net] […] invasive or frequent laboratory testing is most likely to benefit children at greatest risk for MDS, or AML that occurs in the context of MDS (e.g., Fanconi anemia, SDS, SCN[clincancerres.aacrjournals.org] XIAP (1) Immunodeficiency 4 2 50% ATM (1), WAS (1) MPD / MDS 6 2 33% PTPN11 (1), NF1 SETBP1 (1) Neutropenia 5 2 40% VWF (1), HBB (1) Other BMFs 2 0 0% SDS 6 4 67% SBDS (4) SCN[slideshare.net]

    Missing: TCT